PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008233552.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NF-YB
Protein Properties Length: 177aa    MW: 19690.5 Da    PI: 7.6687
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008233552.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB91.58.3e-291571773
           NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalat 73
                    mkk lP+nakisk+aketvqecv efisfvt++as kcqrekrktingddl wa+ t
  XP_008233552.1  1 MKKSLPSNAKISKEAKETVQECVPEFISFVTGKASYKCQREKRKTINGDDLPWAMKT 57
                    9******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.53E-20193IPR009072Histone-fold
PfamPF008088.9E-19155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.0E-251103IPR009072Histone-fold
PRINTSPR006153.3E-81937No hitNo description
PRINTSPR006153.3E-83856No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MKKSLPSNAK ISKEAKETVQ ECVPEFISFV TGKASYKCQR EKRKTINGDD LPWAMKTTSR  60
STEAQGGVAS MTRQEEDPSQ QQQQHHNTSN TNLQHGSNND QTNAVLNANN ISMSTSKVDL  120
FNGGFYFLEG QQQQQQVTQN YNLVSAGTYN LSRINESGDV NGNRDLATHH LHNGIGW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-211551771Transcription factor HapC (Eurofung)
4g92_B1e-211551771Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233552.11e-131PREDICTED: nuclear transcription factor Y subunit B-4-like
TrEMBLM5W0471e-87M5W047_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.15e-30nuclear factor Y, subunit B3